PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G015092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 387aa    MW: 43474.5 Da    PI: 6.3516
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G015092.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++lv  +++ G g+W++ +r  g++R++k+c++rw +yl
  HL.SW.v1.0.G015092.1 14 KGPWTPEEDQKLVTFIHKNGHGSWRALPRLAGLNRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding56.56.2e-1867112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++++eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++l
  HL.SW.v1.0.G015092.1  67 RGKFSQEEEETILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.456961IPR017930Myb domain
SuperFamilySSF466894.12E-3111108IPR009057Homeodomain-like
SMARTSM007171.5E-141363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001671.91E-111661No hitNo description
PROSITE profilePS5129426.87462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2865117IPR009057Homeodomain-like
SMARTSM007172.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.0E-1667112IPR001005SANT/Myb domain
CDDcd001676.86E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLVTFIH KNGHGSWRAL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEETILN LHSILGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
IDPMTHRPRT DIFSSLPHLI ALANLKELMD HPWEEHAVRI QAEAVQNMAK LQYLQYLLQP  180
NSVHNGNQTN FNNLNNSDIE TINLLSSLAS FKDNNNNNNQ NVFDSPQFQN PSSTHHHDLL  240
QSLHDSVSFA HLPDLKIQCS DHDNNNHDER SPHNKQMAIH VENDSDQVPG MAMFSHNNNN  300
NQLILLGQDE MIFSSAAWLP SSACTTPSPP SVAALPVKAP EPAAGITTTF QDQGDACIIN  360
SSYGEEVTHS VWPDHLLDDS LFQDFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022802.11e-139PREDICTED: myb-related protein 308-like
SwissprotQ8GWP01e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A061DHW01e-139A0A061DHW0_THECC; Myb domain protein 93
TrEMBLM5W5261e-139M5W526_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s05360.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93